Salmo trutta (river trout): 115189436 Help Entry 115189436         CDS       T08542                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism stru  Salmo trutta (river trout) Pathway stru04621   NOD-like receptor signaling pathway stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     115189436  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115189436  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:stru03110]     115189436 Chaperones and folding catalysts [BR:stru03110]  Protein folding catalysts   Protein disulfide isomerase    115189436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin AhpC-TSA DIM1 OST3_OST6 Thioredoxin_8 Redoxin Thioredoxin_7 Thioredoxin_9 Thioredoxin_2 Motif Other DBs NCBI-GeneID:  115189436 NCBI-ProteinID:  XP_029603926 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MIIIIEDKEGFDKALEEAGDKLVVVDFTATWCGPCQSIGPFFKGLSENYQSVVFLKVDVD DAPDVASFCDIKCMPTFHFYKNQKKVEEFSGSNQAKLEELVNTHK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgatcatcataatagaagataaggagggctttgacaaggccctggaggaggcaggagat aagctggtggtcgtggacttcacagccacgtggtgcggcccctgtcagagcatcggtcct ttcttcaagggtctgtctgagaattatcagagtgtggtcttcctgaaggttgacgtggac gacgcgccggatgtggccagtttctgtgacatcaagtgtatgccaacattccacttctac aagaaccagaagaaggtggaggagttctcagggtccaatcaggccaaactggaggagctg gtcaacacccacaaataa

DBGET integrated database retrieval system