Salmo trutta (river trout): 115194220 Help Entry 115194220         CDS       T08542                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism stru  Salmo trutta (river trout) Pathway stru03082   ATP-dependent chromatin remodeling stru04217   Necroptosis Brite KEGG Orthology (KO) [BR:stru00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115194220  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     115194220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:stru03036]     115194220   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115194220 Chromosome and associated proteins [BR:stru03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115194220 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115194220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  115194220 NCBI-ProteinID:  XP_029609575 Ensembl:  ENSSTUG00000000660 LinkDB All DBs Position 5:43038635..43040202 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKAISRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggtgggaaggcaggaaaagactccgggaagactaagacaaaggccatttcgcgc tcacagagggcgggtttgcagttccccgtgggtcgtattcacagacatctgaaatccaga acaacgagccatggtcgagttggcgcgactgcagctgtctacagcgcggctattcttgaa tacctaactgctgaggttctggagctggcaggaaatgcatcaaaggatctgaaggtcaag cgtatcactccacgtcacttgcaactggccattagaggcgatgaggagttggattctctc atcaaagcaaccattgctggtggtggtgtcatccctcatatccataagtcactgattgga aagaagggacagcagaagactgtataa

DBGET integrated database retrieval system