Salmo trutta (river trout): 115197147 Help Entry 115197147         CDS       T08542                                  Symbol cd59b Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism stru  Salmo trutta (river trout) Brite KEGG Orthology (KO) [BR:stru00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115197147 (cd59b)    04090 CD molecules [BR:stru04090]     115197147 (cd59b)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:stru00537]     115197147 (cd59b) Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115197147 (cd59b)   Exosomal proteins of other body fluids (saliva and urine)    115197147 (cd59b)   Exosomal proteins of colorectal cancer cells    115197147 (cd59b) CD molecules [BR:stru04090]  Proteins   115197147 (cd59b) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:stru00537]  Antigens   115197147 (cd59b) SSDB OrthologParalogGFIT Motif Pfam:  CD59 UPAR_LY6 Motif Other DBs NCBI-GeneID:  115197147 NCBI-ProteinID:  XP_029614263 LinkDB All DBs Position 7:22390402..22392663 Genome browser AA seq 118 aa AA seqDB search MKRSLGLCLVVCFGILDLGCALRCFKCSDYTGRCENVQDCTYEDSCLSLSERGGKTIRQC IRYTDCDNSRLSQMFPAVSGFTYRCCSSNLCNSSTTIATRGPVFALMGSLLVFWWSSL NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgaagcgctcccttggactttgcttggtggtctgttttgggatactcgatttgggctgt gcacttcggtgcttcaagtgctccgattacacaggccgctgtgaaaatgttcaagactgc acttatgaagattcctgtttatctctgagtgaaagaggtgggaagacaattcgacagtgt atcagatacacagattgtgacaattctcggctgtcccagatgttccctgcagtctccgga ttcacgtaccggtgttgcagcagcaacctgtgtaatagtagtaccactattgccacgaga ggaccagttttcgctttgatggggtcactattggtcttctggtggtcctcactgtga

DBGET integrated database retrieval system