Salmo trutta (river trout): 115197299 Help Entry 115197299         CDS       T08542                                  Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism stru  Salmo trutta (river trout) Pathway stru04010   MAPK signaling pathway stru04012   ErbB signaling pathway stru04068   FoxO signaling pathway stru04137   Mitophagy - animal stru04140   Autophagy - animal stru04144   Endocytosis stru04150   mTOR signaling pathway stru04210   Apoptosis stru04218   Cellular senescence stru04370   VEGF signaling pathway stru04371   Apelin signaling pathway stru04510   Focal adhesion stru04540   Gap junction stru04625   C-type lectin receptor signaling pathway stru04810   Regulation of actin cytoskeleton stru04910   Insulin signaling pathway stru04912   GnRH signaling pathway stru04916   Melanogenesis stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     115197299    04150 mTOR signaling pathway     115197299  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115197299    04140 Autophagy - animal     115197299    04137 Mitophagy - animal     115197299  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115197299   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115197299    04031 GTP-binding proteins [BR:stru04031]     115197299 Membrane trafficking [BR:stru04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     115197299  Endocytosis   Macropinocytosis    Ras GTPases     115197299 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115197299   Exosomal proteins of colorectal cancer cells    115197299 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115197299 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin AAA_16 Motif Other DBs NCBI-GeneID:  115197299 NCBI-ProteinID:  XP_029614543 LinkDB All DBs Position 7:complement(34354788..34380162) Genome browser AA seq 218 aa AA seqDB search MWCFFDGVYPAVVKLSRVQQCVCVWGAVRMTEYKLVVVGAGGVGKSALTIQLIQNHFVDE YDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFE DIHQYREQIKRVKDSDDVPMVLVGNKCDLPSRTVDTRQAQELARSYGIPYIETSAKTRQG VEDAFYTLVREIRQHKLRKLNPPDESGQDCMSCRCVVS NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgtggtgtttttttgatggtgtgtatcctgctgtcgtcaaactgtccagagtccagcag tgtgtgtgtgtgtggggagcagtgaggatgacggagtacaagttggtggtggtgggggct ggaggtgtggggaagagtgcactcaccatccagctcatccagaaccactttgtggatgaa tacgaccccactatagaggactcatacaggaagcaggtggtgattgacggggagacatgt ctgctggacatcctggacactgcaggtcaggaggagtacagcgccatgagggaccagtac atgaggacaggggagggcttcctctgtgtcttcgccatcaacaacaccaagtccttcgag gacatccaccagtacagggaacagatcaagcgtgtgaaagactctgacgacgtgcccatg gtcctggtgggtaataaatgtgacctcccatcgcgtaccgtggacacgcggcaagcacag gaactggcccgcagctacggaattccctacatcgagacctctgccaagacacgacagggg gtagaggacgccttctatacgttagtgagagagatcaggcagcacaagctgaggaagctc aaccctccggacgagagtggacaggactgcatgagctgccgctgtgtggtgtcgtga

DBGET integrated database retrieval system