Salmo trutta (river trout): 115200108 Help Entry 115200108         CDS       T08542                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism stru  Salmo trutta (river trout) Pathway stru04137   Mitophagy - animal stru04140   Autophagy - animal stru04144   Endocytosis stru04145   Phagosome stru04148   Efferocytosis stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115200108    04145 Phagosome     115200108    04140 Autophagy - animal     115200108    04137 Mitophagy - animal     115200108    04148 Efferocytosis     115200108  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115200108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115200108   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115200108    04031 GTP-binding proteins [BR:stru04031]     115200108 Membrane trafficking [BR:stru04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     115200108 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115200108   Exosomal proteins of other body fluids (saliva and urine)    115200108   Exosomal proteins of colorectal cancer cells    115200108   Exosomal proteins of bladder cancer cells    115200108 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     115200108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase PduV-EutP cobW ATP_bind_1 nSTAND3 Septin AAA_16 AAA_22 AAA_7 NTPase_1 AAA_24 G-alpha AAA_5 SRPRB DUF5992 ATPase_2 NACHT NB-ARC ATP-synt_ab AAA_14 ABC_tran Motif Other DBs NCBI-GeneID:  115200108 NCBI-ProteinID:  XP_029618705 Ensembl:  ENSSTUG00000026009 LinkDB All DBs Position 9:complement(18973013..18976351) Genome browser AA seq 205 aa AA seqDB search MASRKKILLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCTSKGSIPYFETSAKEAINVDQAFQTICRNALKQESEV ETYDFPDQIKLRDDRPASSSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcggaagaagattctactcaaggtgataattcttggagactcaggagttggg aagacctctctcatgaaccaatatgtgaataagaagttcagcaatcagtataaggccaca atcggtgctgactttcttaccaaagaggtgatggtggatgacaggcttgtgacaatgcag atctgggacactgcagggcaggagagattccagtcattgggcgttgctttctatcgaggt gcagactgttgtgtccttgtgtacgatgttactgctccaaacaccttcaagactcttgac agctggcgagacgagttcctgattcaagccagcccccgtgacccagagaacttcccattt gttgtgctcggcaacaagattgacttggagaacaggcaggtgacgaccaagagagcccag gcgtggtgtacgagtaagggcagtatcccatatttcgagacaagtgcgaaggaggccatc aatgttgatcaagcctttcaaactatttgccgaaatgctctcaaacaggagtcagaagtg gagacttatgacttcccagatcagatcaaactgagggatgacagaccagcttcctccagt gatggctgcagctgctga

DBGET integrated database retrieval system