Salmo trutta (river trout): 115201607 Help Entry 115201607         CDS       T08542                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism stru  Salmo trutta (river trout) Pathway stru04060   Cytokine-cytokine receptor interaction stru04218   Cellular senescence stru04620   Toll-like receptor signaling pathway stru04621   NOD-like receptor signaling pathway stru04622   RIG-I-like receptor signaling pathway stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115201607  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:stru04052]     115201607    00536 Glycosaminoglycan binding proteins [BR:stru00536]     115201607 Cytokines and neuropeptides [BR:stru04052]  Cytokines   Chemokines    115201607 Glycosaminoglycan binding proteins [BR:stru00536]  Heparan sulfate / Heparin   Chemokines    115201607 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  115201607 NCBI-ProteinID:  XP_029621243 Ensembl:  ENSSTUG00000012638 LinkDB All DBs Position 1:complement(56009918..56011808) Genome browser AA seq 97 aa AA seqDB search MSIRMSASLVVVLLALLTITEGMSLRGMGADLRCRCIETESRRIGRLIKKVEMFPPSSHC RDTEIIATLSNSGQEICLDVSAPWVKRVIEKMLANNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagaatgtcagccagccttgtcgttgtgctcctggccctcctgactattact gaggggatgagtctgagaggcatgggggctgacctgcgatgtcgctgcattgagacagaa agcagaagaattggtagactcattaagaaggtggagatgttccctcccagctcgcactgc agagacactgagatcattgcaactctgagcaacagcggtcaggagatttgtctggatgtc agcgctccttgggtcaagagggtcattgagaagatgctggccaacaacaaatga

DBGET integrated database retrieval system