Salmo trutta (river trout): 115202151 Help Entry 115202151         CDS       T08542                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism stru  Salmo trutta (river trout) Pathway stru03030   DNA replication stru03410   Base excision repair stru03420   Nucleotide excision repair stru03430   Mismatch repair stru03440   Homologous recombination Brite KEGG Orthology (KO) [BR:stru00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     115202151 (pold4)    03410 Base excision repair     115202151 (pold4)    03420 Nucleotide excision repair     115202151 (pold4)    03430 Mismatch repair     115202151 (pold4)    03440 Homologous recombination     115202151 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:stru03032]     115202151 (pold4)    03400 DNA repair and recombination proteins [BR:stru03400]     115202151 (pold4) DNA replication proteins [BR:stru03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     115202151 (pold4) DNA repair and recombination proteins [BR:stru03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       115202151 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      115202151 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  115202151 NCBI-ProteinID:  XP_029621945 Ensembl:  ENSSTUG00000034996 UniProt:  A0A674C6E5 LinkDB All DBs Position 11:complement(6399035..6401120) Genome browser AA seq 110 aa AA seqDB search MTAKRAALITDSYKVVKRSRREEKREKRAPSPPQKDTEPRPLTAREIELQELRQFDQDWR YGPCTGISRLQRWERAAQHGLNPPQEIRDMLLSADTDPDYTHCLWSDYPL NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgacggccaaacgtgcagctctgatcaccgattcctacaaggtggtaaagagatccagg agagaggagaagagagagaagagggccccatcgcctccccagaaggacactgagccgcgc cccctcacggccagagagatagagctgcaggagctgaggcagtttgaccaggactggcgg tatggaccctgcacaggtatcagtcgcttgcagcggtgggagagagctgcacagcatggg ttaaacccccctcaggagatcagagacatgctgcttagcgcagacacagacccggactac acacactgcctgtggagtgactatccattgtga

DBGET integrated database retrieval system