Salmo trutta (river trout): 115203241 Help Entry 115203241         CDS       T08542                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism stru  Salmo trutta (river trout) Pathway stru04010   MAPK signaling pathway stru04137   Mitophagy - animal stru04140   Autophagy - animal stru04218   Cellular senescence stru04371   Apelin signaling pathway stru04625   C-type lectin receptor signaling pathway stru04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115203241    04371 Apelin signaling pathway     115203241  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115203241    04137 Mitophagy - animal     115203241   09143 Cell growth and death    04218 Cellular senescence     115203241   09142 Cell motility    04810 Regulation of actin cytoskeleton     115203241  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115203241  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115203241    04031 GTP-binding proteins [BR:stru04031]     115203241 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115203241   Exosomal proteins of bladder cancer cells    115203241 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115203241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 SLFN-g3_helicase FeoB_N Motif Other DBs NCBI-GeneID:  115203241 NCBI-ProteinID:  XP_029623615 Ensembl:  ENSSTUG00000021894 UniProt:  A0A673ZYB3 LinkDB All DBs Position 12:25295301..25346480 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcagggtggaaggacggctcggtgcaggagaagtatcgactggttgtggttggaggt ggtggtgtcgggaagtcagccctaactatacaatttatccagtcctactttgtcactgac tatgatcccacgattgaagactcgtatacgaagcagtgtgtcattgacgagagggcggcc cggcttgacatcctggacacggccggacaggaagagtttggagccatgagagaacaatac atgaggacaggggagggcttcctgcttgtcttctcagtcactgacagaggaagctttgaa gaaatctacaaattccaaagacagatcctcagagtcaaagaccgtgatgaatttcccatg atccttgtaggcaataaagcagatctggagctccagagacaggtgacccaggaggagggc cagcagctggccagacagctcaaggtgacgtatatggaggcctcagccaaaatccgtatg aatgtagaccaggctttccacgagctggttagagtaatcaggaaattccaggaacaggaa tgcccaccctcgccagaacccacgcggaaagaaaaggacaagagtggctgccattgtgta atcgtctga

DBGET integrated database retrieval system