Salmo trutta (river trout): 115203522 Help Entry 115203522         CDS       T08542                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism stru  Salmo trutta (river trout) Pathway stru04020   Calcium signaling pathway stru04070   Phosphatidylinositol signaling system stru04114   Oocyte meiosis stru04218   Cellular senescence stru04261   Adrenergic signaling in cardiomyocytes stru04270   Vascular smooth muscle contraction stru04371   Apelin signaling pathway stru04625   C-type lectin receptor signaling pathway stru04744   Phototransduction stru04910   Insulin signaling pathway stru04912   GnRH signaling pathway stru04916   Melanogenesis Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     115203522    04020 Calcium signaling pathway     115203522    04070 Phosphatidylinositol signaling system     115203522  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     115203522    04218 Cellular senescence     115203522  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115203522   09152 Endocrine system    04910 Insulin signaling pathway     115203522    04912 GnRH signaling pathway     115203522    04916 Melanogenesis     115203522   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     115203522    04270 Vascular smooth muscle contraction     115203522   09157 Sensory system    04744 Phototransduction     115203522  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:stru01009]     115203522   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115203522    03036 Chromosome and associated proteins [BR:stru03036]     115203522   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115203522 Protein phosphatases and associated proteins [BR:stru01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      115203522 Membrane trafficking [BR:stru04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     115203522 Chromosome and associated proteins [BR:stru03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      115203522 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115203522 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 EF-hand_11 EF-hand_5 EAP30 EFhand_Ca_insen GPHH Motif Other DBs NCBI-GeneID:  115203522 NCBI-ProteinID:  XP_029624144 Ensembl:  ENSSTUG00000008351 LinkDB All DBs Position 12:complement(38918235..38928051) Genome browser AA seq 153 aa AA seqDB search MAKFLSGTQINEFKECFSLYDKKRKGKIEAKDLITVMRCLGTSPTFGEIDRHLQVHKIDK KGELDFSTFLTMMHRQIQQEDPKAEILEAMRMTDKQKKGYILASELRAKLTKLGEKLTDK EVDELFREANVKSNGKVHYEEFTRMVTLPSVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaaattcctgtcaggaactcagatcaacgagttcaaggaatgtttctccttgtac gacaagaagcgcaaggggaagattgaagccaaggacctgatcacagttatgcgctgtctg gggacgagtcccaccttcggtgagatcgaccgacacctgcaggtccacaagatagataag aagggcgagctagacttctccaccttcctgaccatgatgcatcggcagatccagcaggag gaccccaaggcggagatcctggaggccatgaggatgacggacaagcagaagaagggctac atcctggcctcagagctccgggccaagctcaccaagctgggagagaagctaactgataaa gaagtggacgagctattcagagaagccaacgtgaagtctaatggcaaggtgcactatgag gagttcaccaggatggtgacactaccatcagtggattactga

DBGET integrated database retrieval system