Salmo trutta (river trout): 115207478 Help Entry 115207478         CDS       T08542                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism stru  Salmo trutta (river trout) Pathway stru03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:stru00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     115207478  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:stru03036]     115207478    03400 DNA repair and recombination proteins [BR:stru03400]     115207478 Chromosome and associated proteins [BR:stru03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      115207478 DNA repair and recombination proteins [BR:stru03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      115207478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Histone Bromo_TP Serine_rich Anti-adapt_IraP Motif Other DBs NCBI-GeneID:  115207478 NCBI-ProteinID:  XP_029630429 LinkDB All DBs Position 14:15019735..15023113 Genome browser AA seq 141 aa AA seqDB search MLSTTSCLANVNCREKMATAMDEEERKLQRLKAAVHYTVGRLCQNIGEDHQKEFSRQVIA AIAETTFRQCDIFAKDLEAFARHAKRNTVSVEDVKLTARRSTALSNFIQRKSEEIGSANQ EQRDTRKKIAGKRKNKDTEMV NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgctatccactactagctgcctagctaacgtgaactgtcgggagaaaatggcaacagca atggacgaggaggaaagaaaacttcagagactgaaagcagcagtccactatacagtggga agactgtgtcaaaacattggtgaggatcatcagaaggaattcagccgacaggttatagca gcaatagctgaaacgacgttcaggcaatgtgatatttttgcaaaggacttggaggccttt gcaaggcatgccaaaagaaacacagtatctgtagaggatgtgaagcttacagctcgtcga agtacagcactgtctaacttcatacaaaggaagagtgaagagattggcagcgccaaccag gagcagagagacacaaggaagaagattgctgggaagaggaagaataaggatacagagatg gtgtag

DBGET integrated database retrieval system