Salmo trutta (river trout): 115208179 Help Entry 115208179         CDS       T08542                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism stru  Salmo trutta (river trout) Pathway stru04081   Hormone signaling stru04144   Endocytosis stru04150   mTOR signaling pathway stru04270   Vascular smooth muscle contraction stru04310   Wnt signaling pathway stru04350   TGF-beta signaling pathway stru04510   Focal adhesion stru04520   Adherens junction stru04530   Tight junction stru04621   NOD-like receptor signaling pathway stru04625   C-type lectin receptor signaling pathway stru04810   Regulation of actin cytoskeleton stru05100   Bacterial invasion of epithelial cells stru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115208179    04350 TGF-beta signaling pathway     115208179    04150 mTOR signaling pathway     115208179   09133 Signaling molecules and interaction    04081 Hormone signaling     115208179  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115208179  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     115208179  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:stru04131]     115208179   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115208179    04031 GTP-binding proteins [BR:stru04031]     115208179 Membrane trafficking [BR:stru04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     115208179 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115208179   Exosomal proteins of other body fluids (saliva and urine)    115208179   Exosomal proteins of colorectal cancer cells    115208179   Exosomal proteins of bladder cancer cells    115208179 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     115208179 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  115208179 NCBI-ProteinID:  XP_029631899 Ensembl:  ENSSTUG00000046689 LinkDB All DBs Position 14:complement(44407080..44413078) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKPRNKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccatccgaaagaagctggtcatagtgggagatggcgcatgtggtaagacgtgt ctgctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccactgtcttcgag aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca gcaggccaggaggactatgataggctccgccccctatcttacccagatacagatgtcatc cttatgtgcttctctatcgatagccctgacagtttggaaaacatcccagagaaatggact ccagaggtcaaacacttctgtcccaacgttcccatcatcctagtgggcaataaaaaggac ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag ccagaggagggacgtgacatggcgaaccggatcagtgccttcggctacatggagtgctct gcaaagaccaaggatggtgtgagggaagtgtttgagatggccaccagggcggcgctacag gcccggcgggggaagccaagaaataaatgcctcctactgtaa

DBGET integrated database retrieval system