Streptomyces sp. VN1: EZV63_26200 Help Entry EZV63_26200       CDS       T10674                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism strv  Streptomyces sp. VN1 Pathway strv00998   Biosynthesis of various antibiotics strv01100   Metabolic pathways strv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EZV63_26200    00074 Mycolic acid biosynthesis     EZV63_26200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EZV63_26200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4148 Motif Other DBs NCBI-ProteinID:  QIP72897 LinkDB All DBs Position 5760665..5760916 Genome browser AA seq 83 aa AA seqDB search MTDTYDVIRSVLTTTFQIPDAEISPERTLEQLELDSLALAEFALILQERLEVPVDEEHAT RTTTLAQVTEHLDALRAQSVATQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgacacctacgacgtgatccgctccgtgctgacgacgacgttccagatcccggat gcggagatcagtcccgagcgcaccctcgaacagctcgaactggactccctcgccctcgcc gagttcgcgctcatcctccaggaacgcctggaggtgccggtcgacgaggagcacgccacc cgcaccaccaccctcgcgcaggtcacggagcacctcgacgccctgcgggcccagtcggtg gccacgcagtga

DBGET integrated database retrieval system