Streptomyces sp. WP-1: QHG49_09130 Help Entry QHG49_09130       CDS       T10379                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism strw  Streptomyces sp. WP-1 Pathway strw00261   Monobactam biosynthesis strw01100   Metabolic pathways strw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QHG49_09130  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strw01008]     QHG49_09130 Polyketide biosynthesis proteins [BR:strw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QHG49_09130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WKE69180 LinkDB All DBs Position 2150263..2150469 Genome browser AA seq 68 aa AA seqDB search MSNPFEKSDRSYDVLVNEEGQHSLWPSGTAAPDGWETVLAGRPREECLAYVETNWTDMRP RSLRTSVA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtccaacccgttcgagaagtccgaccgttcgtacgacgtcctcgtgaacgaggagggc cagcactcgctgtggccgtccggcacggccgccccggacggctgggagaccgtcctcgcc ggccggccccgcgaggagtgcctcgcgtacgtcgagacgaactggaccgacatgcgcccg cgcagtctgcgcacgtccgtcgcctga

DBGET integrated database retrieval system