Streptomyces sp. WP-1: QHG49_21635 Help Entry QHG49_21635       CDS       T10379                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism strw  Streptomyces sp. WP-1 Brite KEGG Orthology (KO) [BR:strw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:strw03032]     QHG49_21635    03036 Chromosome and associated proteins [BR:strw03036]     QHG49_21635    03400 DNA repair and recombination proteins [BR:strw03400]     QHG49_21635 DNA replication proteins [BR:strw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QHG49_21635 Chromosome and associated proteins [BR:strw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QHG49_21635 DNA repair and recombination proteins [BR:strw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QHG49_21635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta DUF7342 HU-HIG Motif Other DBs NCBI-ProteinID:  WKE71432 LinkDB All DBs Position 4928945..4929226 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGEPINIPAGFSVKVTAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgtgccgaggtgacccgcaaggac gccgacgccgtgctggccgcgttcgccgagaccgtcggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgtacc gcgcgcaacccgcagaccggcgagccgatcaacatccccgccgggttcagcgtgaaggtc accgcgggctccaagctcaaggaagcggccaagggcaagtaa

DBGET integrated database retrieval system