Streptomyces sp. S6: EQG64_29255 Help Entry EQG64_29255       CDS       T07981                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stry  Streptomyces sp. S6 Pathway stry00998   Biosynthesis of various antibiotics stry01100   Metabolic pathways stry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EQG64_29255    00074 Mycolic acid biosynthesis     EQG64_29255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EQG64_29255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QCW79886 LinkDB All DBs Position 6636597..6636830 Genome browser AA seq 77 aa AA seqDB search MTTSEEISALLVAKFGTDPEALGPDVPLHRLRLDSLALEELRLLIEDRLDVDLEDVVLTS RDTLGRLIEAVQVKVAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaccacgtcggaagagatcagcgccctgctggtagcgaagttcggaaccgaccccgag gcccttggccccgacgttccgctgcaccggctgcggctggactccctcgccctggaggag ctgcggctgctcatcgaggaccggctcgacgtcgatctggaggacgtcgtgctcacttcg cgcgacaccctcgggcggctgatcgaggccgtccaggtcaaggtcgccgcgtga

DBGET integrated database retrieval system