Streptomyces sp. S6: EQG64_31665 Help Entry EQG64_31665       CDS       T07981                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stry  Streptomyces sp. S6 Pathway stry00998   Biosynthesis of various antibiotics stry01100   Metabolic pathways stry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EQG64_31665    00074 Mycolic acid biosynthesis     EQG64_31665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EQG64_31665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QCW80144 LinkDB All DBs Position complement(7203595..7203858) Genome browser AA seq 87 aa AA seqDB search MTTMSDLTRTTVVTRINESLGHVLQRELEPADESPRLFDDLGLDSTSVLELLMRLEDELG IEFDTDSLEQHHFDSVGTLADYVIEQA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgaccaccatgtccgacctcacccgcaccaccgtcgtcacccggatcaacgagtcgctc ggccatgtcctccagcgcgagctggagcccgccgacgagtcgccccgcctcttcgacgac ctcggcctggactccaccagcgtgctggagctgctgatgcggctggaggacgaactcggc atcgagttcgacaccgactcgctggagcagcaccacttcgacagcgtcggcaccctcgcc gactatgtgatcgagcaggcctga

DBGET integrated database retrieval system