Streptomyces sp. 71268: OYE22_21820 Help Entry OYE22_21820       CDS       T09829                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism strz  Streptomyces sp. 71268 Brite KEGG Orthology (KO) [BR:strz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:strz03032]     OYE22_21820    03036 Chromosome and associated proteins [BR:strz03036]     OYE22_21820    03400 DNA repair and recombination proteins [BR:strz03400]     OYE22_21820 DNA replication proteins [BR:strz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     OYE22_21820 Chromosome and associated proteins [BR:strz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     OYE22_21820 DNA repair and recombination proteins [BR:strz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       OYE22_21820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta A_thal_3526 HU-HIG Motif Other DBs NCBI-ProteinID:  WEV27531 LinkDB All DBs Position 5520631..5520909 Genome browser AA seq 92 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAALAETVGEVVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgactcgtaaggac gcggacgccgtgctggccgcgctcgccgagaccgtcggtgaggtcgttgctaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgtacc gcgcgcaacccgcagaccggcgaccccatccagatcccggccggttacagcgtgaaggtc tccgcgggctccaagctcaaggaagccgccaagggctga

DBGET integrated database retrieval system