Streptomyces sp. S1D4-11: HEP87_18630 Help Entry HEP87_18630       CDS       T10399                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stsd  Streptomyces sp. S1D4-11 Pathway stsd00998   Biosynthesis of various antibiotics stsd01100   Metabolic pathways stsd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stsd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP87_18630    00074 Mycolic acid biosynthesis     HEP87_18630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP87_18630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QIY95683 LinkDB All DBs Position 4010093..4010341 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgaaggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system