Streptomyces sp. Sge12: B6R96_13870 Help Entry B6R96_13870       CDS       T11356                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stsg  Streptomyces sp. Sge12 Pathway stsg00998   Biosynthesis of various antibiotics stsg01100   Metabolic pathways stsg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stsg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B6R96_13870    00074 Mycolic acid biosynthesis     B6R96_13870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B6R96_13870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARE74906 LinkDB All DBs Position 3184585..3184830 Genome browser AA seq 81 aa AA seqDB search MTREEIISGLAEILNEVADVEPADVTEEKHFIDDLDVDSLAMVEVIVAAEERFGVTLPEE ELKELQLVSDIVIRIEKQLAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgcgtgaagagatcatctccggactcgccgagatcctgaacgaggtcgccgacgtc gaaccggccgacgtgaccgaggagaagcacttcatcgacgacctcgacgtcgactccctc gccatggtcgaggtcatcgtcgcagccgaggagcgcttcggggtcaccctccccgaggag gagctcaaggagctccagctcgtgtccgacatcgtgatccgcatcgagaagcagctggcc gcctga

DBGET integrated database retrieval system