Streptomyces sp. Sge12: B6R96_20720 Help Entry B6R96_20720       CDS       T11356                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism stsg  Streptomyces sp. Sge12 Pathway stsg00998   Biosynthesis of various antibiotics stsg01100   Metabolic pathways stsg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stsg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B6R96_20720    00074 Mycolic acid biosynthesis     B6R96_20720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B6R96_20720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ARE76075 LinkDB All DBs Position 4618623..4618919 Genome browser AA seq 98 aa AA seqDB search MLRVSVSGFQRRGCVVLQSADLDSVRSFVVRELVDFGAESDKVVDGARLEELEIDSLGVV ELTASIKREFGVDVPLEALTKDVTVAGVIALIQGAAAA NT seq 297 nt NT seq  +upstreamnt  +downstreamnt ctgctgcgcgtttccgtgtccggatttcagagacgaggatgtgttgtgctccagagcgcc gatcttgattccgtccgttccttcgtcgtgcgcgagctcgtcgacttcggggcggagtcc gacaaggtcgtggacggggccaggctggaggagctggagatcgactccctcggcgtcgtc gaactcaccgcgtccatcaagcgcgagttcggcgtcgacgtccccctggaggcgctgacg aaggacgtcaccgtcgccggggtgatcgccctgatccagggggcggcagcagcctga

DBGET integrated database retrieval system