KEGG   Streptomyces qaidamensis: A4E84_28545
Entry
A4E84_28545       CDS       T04777                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00770  Pantothenate and CoA biosynthesis
stsi01100  Metabolic pathways
stsi01240  Biosynthesis of cofactors
Module
stsi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A4E84_28545
Enzymes [BR:stsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     A4E84_28545
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig HcgB
Other DBs
NCBI-ProteinID: AMW13095
UniProt: A0A143C826
LinkDB
Position
6400172..6400651
AA seq 159 aa
MRRAVCPGSFDPITNGHLDIISRASRLYDEVYVAVMINQAKKGLFEIEERIDLIRRVTAE
YGNVRVEAFHGLLVDFCKQREIPAIVKGLRAVSDFDYELQMAQMNNGLSGVETLFIPTNP
TYSFLSSSLVKEVATWGGDVSHLVPAEVLGVLTERLRKD
NT seq 480 nt   +upstreamnt  +downstreamnt
gtgcgccgcgccgtctgtcccgggtcgttcgacccgatcaccaacggacacctcgacatc
atctcccgcgcctccaggctgtacgacgaggtctatgtcgcggtgatgatcaaccaggcc
aagaagggcctgttcgagatcgaggagcggatcgacctgatccgccgggtcaccgccgag
tacggcaacgtccgagtggaggcattccacggcctgctcgtcgacttctgcaagcagcgc
gagatccccgccatcgtcaagggcctgcgcgcggtcagtgacttcgactacgagctgcag
atggcccagatgaacaatggcctctcgggcgtggagaccctcttcatccccaccaacccc
acctacagcttcctgtcgtcctccctggtcaaggaggtcgcgacctggggcggcgacgtc
tcccacctggtacccgcggaggtcctcggcgtcctcaccgagcgcctgcggaaggactga

DBGET integrated database retrieval system