Streptomyces qaidamensis: A4E84_31180 Help Entry A4E84_31180       CDS       T04777                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism stsi  Streptomyces qaidamensis Pathway stsi03060   Protein export stsi03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:stsi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     A4E84_31180  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     A4E84_31180  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:stsi02044]     A4E84_31180 Secretion system [BR:stsi02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    A4E84_31180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AMW13576 UniProt:  A0A143C7Z9 LinkDB All DBs Position 7039483..7039698 Genome browser AA seq 71 aa AA seqDB search MLRNGLEPWHLLIVAIVVIVLFGSKKLPDTARSLGRSMRILKSEAKALKGEGGSGAAPGE QTRSTAPADAG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgctgcgcaacggactggagccctggcatctgctgatcgtggcgatcgtcgtgatcgtc ctgttcggttcgaagaagctgccggacacggcgcgatcgctgggccgctcgatgcggatc ctcaagagcgaggccaaggcgctgaagggggagggcggttcgggcgcggcgcccggcgag cagacccggtccaccgcgcccgcggacgccggctag

DBGET integrated database retrieval system