Streptomyces tsukubensis: B7R87_08635 Help Entry B7R87_08635       CDS       T07155                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stsu  Streptomyces tsukubensis Pathway stsu00998   Biosynthesis of various antibiotics stsu01100   Metabolic pathways stsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stsu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B7R87_08635    00074 Mycolic acid biosynthesis     B7R87_08635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B7R87_08635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AZK93937 LinkDB All DBs Position 2270239..2270487 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAAQYILDHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcgagggcctcgccgagatcgtgaacgagatcgcc gggatccccgtcgaggacgttcagctcgacaagtccttcaccgacgacctggacgtggat tccctctccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctgaagaccgtcggcgacgccgcgcagtacatcctcgaccac cagggctga

DBGET integrated database retrieval system