KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t1077
Entry
t1077             CDS       T00121                                 
Name
(GenBank) conserved hypothetical protein
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:stt01002]
    t1077
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stt01011]
    t1077
Enzymes [BR:stt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     t1077
Peptidases and inhibitors [BR:stt01002]
 Serine peptidases
  Family S66
   t1077
Peptidoglycan biosynthesis and degradation proteins [BR:stt01011]
 Precursor biosynthesis
  Carboxypeptidase
   t1077
SSDB
Motif
Pfam: Peptidase_S66C Peptidase_S66
Other DBs
NCBI-ProteinID: AAO68743
UniProt: Q8Z689
LinkDB
Position
complement(1159817..1160731)
AA seq 304 aa
MSLFHLIAPSGYCINQQAALRGVQRLTDAGHQVENDEVIRRRYQRFAGTDAERLADVNSL
ASLTSPDTIVMPVRGGYGASRLLDRIDWQALASRQQRDPLLICGHSDFTAIQAGLLAQAN
VITFSGPMLAANFGAETLNTFTEQHFWLALRKAQFTVEWQGDGPQCDVQGTLWGGNLAML
ISLIGTPWMPTIDKGILVLEDVNEHPFRVERMLLQLEYAGILNRQSAIVLGSFSGAAPNE
YDAGYSLESVYAFLRSRLSVPLITGLDFGHEQRTVTLPIGANATLKNTRQGTQLTLSGHP
TLQL
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtctctgtttcatttaatcgccccctcgggctactgtattaaccaacaggccgcgtta
cgcggcgttcagcgcctgactgacgcgggtcatcaggtggagaatgacgaggtgattcgt
cgccgctatcagcgttttgccggtacggacgcggaacggctggccgatgttaattcgctg
gcctcgctaacttcgccggatacgatcgtcatgccggttcgcggcggctatggcgccagc
cgcttgctggatcgtatcgactggcaggcgctcgcctcccggcaacagcgcgatccctta
ctgatttgcggtcatagcgattttacggcgattcaggctggactactggcgcaggccaat
gtcatcacctttagcggtcctatgctggcggcaaattttggcgccgaaacgctgaatacg
ttcaccgagcaacatttctggctggcgctacgcaaggcgcaatttaccgtagagtggcaa
ggcgacggccctcagtgcgacgtacagggcaccttatggggcggaaatctggcgatgttg
atttcccttatcggtacgccctggatgccgactatcgataaaggaattttagtgctggaa
gatgtcaatgagcatcctttccgggtggagcgtatgcttttgcaactggagtacgccgga
attctaaaccgtcagagcgccatcgttctcggcagctttagcggcgcggcgcccaacgag
tatgacgccggctattctctggagagcgtctacgcgtttttacgttcccgtctgtccgtt
ccgctgattaccggtctcgacttcgggcatgaacagcgtacggtgacgctccctatcggg
gcaaacgcaacgcttaaaaatacgcgccaggggactcaactcactttatctggtcatcct
acgctgcaattgtaa

DBGET integrated database retrieval system