Streptomyces sp. TN58: BSL84_04750 Help Entry BSL84_04750       CDS       T09761                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sttn  Streptomyces sp. TN58 Pathway sttn00998   Biosynthesis of various antibiotics sttn01100   Metabolic pathways sttn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sttn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSL84_04750    00074 Mycolic acid biosynthesis     BSL84_04750   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSL84_04750 BRITE hierarchy Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  APU39180 LinkDB All DBs Position complement(1045350..1045592) Genome browser AA seq 80 aa AA seqDB search MANDDVFDRLTTCTVDVLQVKAASVTPDAHLADDLGASSLIQVELVMAIEEEFGISVPDE SVEEIQTVGDLHRLILSLVA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggctaacgacgacgttttcgaccggctcaccacctgcaccgtcgacgtcctgcaggtc aaggccgcgtccgtgaccccggacgcgcatctggccgacgacctgggcgccagcagcctc atccaggtcgagctggtcatggccatcgaggaggagttcggcatctcggtgcccgacgag tccgtcgaggagatccagaccgtcggcgacctgcaccggctgatcctttcgctggtcgcc tga

DBGET integrated database retrieval system