Streptomyces sp. TN58: BSL84_12665 Help Entry BSL84_12665       CDS       T09761                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism sttn  Streptomyces sp. TN58 Brite KEGG Orthology (KO) [BR:sttn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sttn03032]     BSL84_12665    03036 Chromosome and associated proteins [BR:sttn03036]     BSL84_12665    03400 DNA repair and recombination proteins [BR:sttn03400]     BSL84_12665 DNA replication proteins [BR:sttn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BSL84_12665 Chromosome and associated proteins [BR:sttn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BSL84_12665 DNA repair and recombination proteins [BR:sttn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BSL84_12665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG A_thal_3526 Motif Other DBs NCBI-ProteinID:  APU40489 UniProt:  A0A1L7GEP2 LinkDB All DBs Position complement(2778897..2779178) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALSERAEVTRKDADAVLAALAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgctctgtccgagcgcgccgaggtgacccgcaaggac gccgacgccgttctggccgcgctcgccgagaccgtcggcgagattgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgaccccatccagatcccggccggctacagcgtgaaggtc tccgcgggctccaagctcaaggaagccgccaagggcaagtag

DBGET integrated database retrieval system