Streptococcus thermophilus JIM 8232: STH8232_0492 Help Entry STH8232_0492      CDS       T02026                                  Symbol acpP2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stu  Streptococcus thermophilus JIM 8232 Pathway stu01100   Metabolic pathways stu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STH8232_0492 (acpP2)    00074 Mycolic acid biosynthesis     STH8232_0492 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STH8232_0492 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB ACP_SdgA_C Csd3_N DUF6137 Motif Other DBs NCBI-ProteinID:  CCC19224 LinkDB All DBs Position 395652..395876 Genome browser AA seq 74 aa AA seqDB search MAVFEKVQEIIVEELGKDAEEVKVETTFDELDADSLDVFQVISEIEDEFDIQIETEEGLN TVGDLVAYVEEKTK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaaaaagtacaagaaatcattgttgaagaacttgggaaagatgcagaa gaagtaaaagtagaaactacttttgacgaacttgatgctgattcacttgatgtattccaa gttatctcagaaatcgaagatgaattcgatattcaaatcgaaactgaagaaggtcttaat acggttggtgaccttgttgcttacgtagaagagaaaactaaataa

DBGET integrated database retrieval system