Streptomyces tubercidicus: STRTU_003499
Help
Entry
STRTU_003499 CDS
T09099
Name
(GenBank) single-stranded DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
stud
Streptomyces tubercidicus
Pathway
stud03030
DNA replication
stud03430
Mismatch repair
stud03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
stud00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
STRTU_003499
03430 Mismatch repair
STRTU_003499
03440 Homologous recombination
STRTU_003499
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
stud03032
]
STRTU_003499
03400 DNA repair and recombination proteins [BR:
stud03400
]
STRTU_003499
03029 Mitochondrial biogenesis [BR:
stud03029
]
STRTU_003499
DNA replication proteins [BR:
stud03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
STRTU_003499
DNA repair and recombination proteins [BR:
stud03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
STRTU_003499
TLS (translesion DNA synthesis) factors
Other SOS response factors
STRTU_003499
Mitochondrial biogenesis [BR:
stud03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
STRTU_003499
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
tRNA_anti-codon
DUF4131
tRNA_anti_2
SSB_1
NNMT_PNMT_TEMT
Motif
Other DBs
NCBI-ProteinID:
WAU13055
LinkDB
All DBs
Position
complement(4026017..4026607)
Genome browser
AA seq
196 aa
AA seq
DB search
MAGETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPRTFDRQTNEWKDGESLFLTCSVW
RQAAENVAESLTRGTRVVVQGRLKQRSYEDREGVKRTVYELDVEEVGASLKNATAKITKT
SGRGGQGGGGFGGGQQGGGQGGGGWGGGPGGGQQGGGAPADDPWATGGPAGGGQQGGGGG
GWGGSSGGGYSDEPPF
NT seq
591 nt
NT seq
+upstream
nt +downstream
nt
atggcaggcgagaccgtcatcacggttgtcggcaatcttgtcgacgaccccgagctgcgc
ttcaccccgtccggtgcggcggtcgcgaagttccgcgtcgcgtccactccccgcactttc
gaccgtcagaccaatgagtggaaggacggcgagagcctgttcctgacctgctcggtgtgg
cgtcaggcggcggagaacgtcgccgagtccctgacgcggggtacccgcgtggtcgtccag
ggccgcctcaagcagcggtcgtacgaggaccgcgagggcgtgaagcgcacggtctacgag
ctcgacgtcgaggaagtgggcgcgagcctcaagaacgccacggccaagatcaccaagacc
agcggtcgtggtggccagggcggcggcggcttcggcggcggtcagcagggcggcggccag
ggtggcggcggctggggcggcggccccggcggcggccagcagggcggcggtgctcctgcc
gacgacccgtgggcgaccggcggtccggccggcggtggccagcagggtggcggcggcggt
ggctggggcggtagctccggcggtggctactcggacgagccgcccttctag
DBGET
integrated database retrieval system