KEGG   Streptomyces tuirus: GCM10017668_31810
Entry
GCM10017668_31810 CDS       T07360                                 
Symbol
gpmA
Name
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stui  Streptomyces tuirus
Pathway
stui00010  Glycolysis / Gluconeogenesis
stui00260  Glycine, serine and threonine metabolism
stui00680  Methane metabolism
stui01100  Metabolic pathways
stui01110  Biosynthesis of secondary metabolites
stui01120  Microbial metabolism in diverse environments
stui01200  Carbon metabolism
stui01230  Biosynthesis of amino acids
Module
stui_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stui_M00002  Glycolysis, core module involving three-carbon compounds
stui_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:stui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GCM10017668_31810 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    GCM10017668_31810 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GCM10017668_31810 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:stui04131]
    GCM10017668_31810 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stui04147]
    GCM10017668_31810 (gpmA)
Enzymes [BR:stui01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GCM10017668_31810 (gpmA)
Membrane trafficking [BR:stui04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GCM10017668_31810 (gpmA)
Exosome [BR:stui04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GCM10017668_31810 (gpmA)
  Exosomal proteins of melanoma cells
   GCM10017668_31810 (gpmA)
SSDB
Motif
Pfam: His_Phos_1 DUF4015
Other DBs
NCBI-ProteinID: BCL21338
UniProt: A0A7G1NDU9
LinkDB
Position
complement(3436519..3437280)
AA seq 253 aa
MADAPYKLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEAVRGGELLKDADLLPDVVHTS
LQKRAIRTAQLALEAADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPPLDIDDEYSQFHDPRYATLPPELRPRTECLKDVVVRMLPYWFDAIVPDLLTGRT
VLVAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLSYELDAEFKPLNPGGTYLDPEAAA
AAIEAVKNQGKKK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgagtggaacgcg
aagaacctgttcaccggctgggtggacgtcaatctcaacgagaagggcgagaaggaggcg
gtccgcggtggcgagctcctgaaggacgccgatctcctgcccgacgtggtgcacacgtcc
ctccagaagcgcgcgatccgcacggcgcagctggccctggaggccgcggaccgccactgg
atccccgtccaccgcagctggcgcctcaatgagcgccactacggcgccctccagggcaag
gacaaggcccagacgctcgccgagttcggcgaggagcagttcatgctgtggcgccggtcc
tacgacaccccgcccccgccgctcgacatcgacgacgagtactcccagttccacgacccg
cgctacgcgaccctcccgccggagctgcgcccgcgcacggagtgcctgaaggacgtcgtc
gtccgcatgctcccgtactggttcgacgcgatcgtccccgacctgctgaccggccgcacg
gtcctggtcgcggcccacggcaactcgctccgcgccctggtcaagcacctggacggcatc
tccgacgcggacatcgcgggcctcaacatccccacgggcatcccgctctcctacgagctc
gacgccgagttcaagcccctcaacccgggcggcacctacctggaccccgaggcggcggca
gcggccatcgaggcggtcaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system