Streptococcus sp. VT 162: V470_00185 Help Entry V470_00185        CDS       T03287                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stv  Streptococcus sp. VT 162 Pathway stv01100   Metabolic pathways stv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V470_00185    00074 Mycolic acid biosynthesis     V470_00185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V470_00185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7975 DUF6315 Motif Other DBs NCBI-ProteinID:  AHZ46876 LinkDB All DBs Position 32128..32364 Genome browser AA seq 78 aa AA seqDB search MTEKEIFDRIVTIIQERQGADFVVTEALSLKDDLDADSVDLMEFVLTLEDEFGIEITDEE IDQLQSVADVVAIIKDKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgacagaaaaagaaatttttgaccgtattgtaactattatccaagaaagacagggagca gatttcgtcgtgacagaagccttgagtttgaaagacgatctcgatgcagactcagtggac ttgatggagttcgtcttgacactagaagatgaatttggtatcgaaatcactgatgaggaa atcgatcaacttcaaagtgtagcggatgtagtagcaattattaaagataaaaaatag

DBGET integrated database retrieval system