Streptococcus thermophilus MN-ZLW-002: Y1U_C0368 Help Entry Y1U_C0368         CDS       T02116                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stw  Streptococcus thermophilus MN-ZLW-002 Pathway stw01100   Metabolic pathways stw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Y1U_C0368    00074 Mycolic acid biosynthesis     Y1U_C0368   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Y1U_C0368 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB ACP_SdgA_C Csd3_N DUF6137 Motif Other DBs NCBI-ProteinID:  AFJ82817 LinkDB All DBs Position 362045..362269 Genome browser AA seq 74 aa AA seqDB search MAVFEKVQEIIVEELGKDAEEVKVETTFDELDADSLDVFQVISEIEDEFDIQIETEEGLN TVGDLVAYVEEKTK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaaaaagtacaagaaatcattgttgaagaacttgggaaagatgcagaa gaagtaaaagtagaaactacttttgacgaacttgatgctgattcacttgatgtattccaa gttatctcagaaatcgaagatgaattcgatattcaaatcgaaactgaagaaggtcttaat acggttggtgaccttgttgcttacgtagaagagaaaactaaataa

DBGET integrated database retrieval system