Streptococcus thermophilus MN-ZLW-002: Y1U_C0827 Help Entry Y1U_C0827         CDS       T02116                                  Name (GenBank) sugar biosynthesis protein   KO K01790   dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13] Organism stw  Streptococcus thermophilus MN-ZLW-002 Pathway stw00521   Streptomycin biosynthesis stw00523   Polyketide sugar unit biosynthesis stw00541   Biosynthesis of various nucleotide sugars stw01100   Metabolic pathways stw01110   Biosynthesis of secondary metabolites stw01250   Biosynthesis of nucleotide sugars Module stw_M00793   dTDP-L-Rha biosynthesis, Glc-1P => dTDP-L-Rha Brite KEGG Orthology (KO) [BR:stw00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00541 Biosynthesis of various nucleotide sugars     Y1U_C0827   09109 Metabolism of terpenoids and polyketides    00523 Polyketide sugar unit biosynthesis     Y1U_C0827   09110 Biosynthesis of other secondary metabolites    00521 Streptomycin biosynthesis     Y1U_C0827 Enzymes [BR:stw01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.3  Acting on carbohydrates and derivatives     5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase      Y1U_C0827 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dTDP_sugar_isom Motif Other DBs NCBI-ProteinID:  AFJ83276 LinkDB All DBs Position 805475..805813 Genome browser AA seq 112 aa AA seqDB search MGQIKVEKNVGGIEGLCVIEPAVHGDARGYFMETYNEKDMKEAGIDIHFVQDNQSMSTKG VLRGLHFQKQYPQCKLVRAMRGTVFDVAVDLRSDSKSYGKWYGVTLSAENKK NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgggacagataaaagttgagaaaaatgtaggcggtatcgaaggactttgcgttattgaa cctgctgttcatggcgatgctcgtggctatttcatggaaacctacaacgaaaaagatatg aaagaagcaggcattgacatccacttcgtgcaggacaatcagtctatgtccactaagggc gttctgcgcggtttgcatttccagaagcagtatccgcagtgcaagctggtacgcgccatg cgtggtactgtgtttgatgttgcggttgacctgagaagtgattctaagagttacggcaag tggtatggtgttacactgtccgctgagaacaagaagtag

DBGET integrated database retrieval system