Streptococcus thermophilus MN-ZLW-002: Y1U_C1181 Help Entry Y1U_C1181         CDS       T02116                                  Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism stw  Streptococcus thermophilus MN-ZLW-002 Pathway stw02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:stw00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     Y1U_C1181  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:stw02000]     Y1U_C1181 Transporters [BR:stw02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     Y1U_C1181 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AFJ83630 LinkDB All DBs Position complement(1145916..1146179) Genome browser AA seq 87 aa AA seqDB search MASKDFHIVAETGIHARPATLLVQTASKFASDITLEYKGKAVNLKSIMGVMSLGVGQGAD VTISAEGPDADDAIAAIAETMTKEGLA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcttctaaagatttccacattgttgcagaaactggtattcacgcacgaccagctact ttgcttgttcaaacagcaagtaaatttgcttcagatatcactcttgaatacaaaggtaaa gcagttaaccttaaatctatcatgggtgttatgagtcttggtgttggtcaaggtgctgac gtaactatttctgcagaaggtcctgacgctgatgatgcaattgcagcaatcgcagaaaca atgacaaaagaaggattggcataa

DBGET integrated database retrieval system