Streptomyces sp. YIM 121038: C9F11_01245 Help Entry C9F11_01245       CDS       T11066                                  Symbol acpP1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism styi  Streptomyces sp. YIM 121038 Pathway styi00998   Biosynthesis of various antibiotics styi01100   Metabolic pathways styi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:styi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C9F11_01245 (acpP1)    00074 Mycolic acid biosynthesis     C9F11_01245 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C9F11_01245 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 PH_15 Motif Other DBs NCBI-ProteinID:  QCX73952 LinkDB All DBs Position 308381..308668 Genome browser AA seq 95 aa AA seqDB search MVMTLDEATRRAAARQDLCAQVKTLLVERLALNVDPRSIGDDQPLFGRGLELDSIDTLEL AMAVEDTFGVTVTDDDTHSLLSLNRLVDHIEGARA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggtgatgacactcgacgaggcgacccgccgggcagccgcccggcaggacctgtgcgca caggtcaagacgctgctggtcgaacggctcgccctgaacgtcgatccgcgctccatcggc gacgaccagccgctgttcggccgcggcctggaactcgactccatcgacaccctcgaactg gccatggccgtggaggacaccttcggcgtgaccgtcaccgacgacgacacccacagcctg ctgtcgctcaaccggctggtcgaccacatcgaaggcgcccgcgcatga

DBGET integrated database retrieval system