Streptomyces sp. YIM 121038: C9F11_16300 Help Entry C9F11_16300       CDS       T11066                                  Symbol hup Name (GenBank) DNA-binding protein HB1   KO K03530   DNA-binding protein HU-beta Organism styi  Streptomyces sp. YIM 121038 Brite KEGG Orthology (KO) [BR:styi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:styi03032]     C9F11_16300 (hup)    03036 Chromosome and associated proteins [BR:styi03036]     C9F11_16300 (hup)    03400 DNA repair and recombination proteins [BR:styi03400]     C9F11_16300 (hup) DNA replication proteins [BR:styi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C9F11_16300 (hup) Chromosome and associated proteins [BR:styi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C9F11_16300 (hup) DNA repair and recombination proteins [BR:styi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C9F11_16300 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  QCX76921 UniProt:  A0A5B7UT98 LinkDB All DBs Position complement(3910842..3911123) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGEPINIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgtgctggccgcgttcgccgagaccgtcggcgagatcgttgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcccgcaacccgcagaccggcgagccgatcaacatcccggccggttacagcgtcaaggtc tccgcgggcagcaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system