Streptomyces sp. YIM 121038: C9F11_41825 Help Entry C9F11_41825       CDS       T11066                                  Symbol acpP3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism styi  Streptomyces sp. YIM 121038 Pathway styi00998   Biosynthesis of various antibiotics styi01100   Metabolic pathways styi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:styi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C9F11_41825 (acpP3)    00074 Mycolic acid biosynthesis     C9F11_41825 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C9F11_41825 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QCX81945 LinkDB All DBs Position 9915054..9915308 Genome browser AA seq 84 aa AA seqDB search MTTTAPTREALTEFVVEALEDFGAESDAITMDVTFEDLEIDSLDLVELGQAVKKRFGVQV RPKDMDGVKTVGEALDVMFAAAGL NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaccgctcccacccgtgaggccttgacggagttcgtcgtcgaagcgcttgag gacttcggtgccgagtccgacgccatcaccatggacgtcaccttcgaggacctcgagatc gactcgctggacctggtggagctcggccaggccgtcaagaagcggttcggcgtccaggtg cgccccaaggacatggacggcgtcaagacggtgggcgaggcactcgacgtcatgttcgcg gccgcggggctgtga

DBGET integrated database retrieval system