Sulfitobacter albidus: KDD17_13930 Help Entry KDD17_13930       CDS       T09114                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sual  Sulfitobacter albidus Pathway sual01100   Metabolic pathways sual01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sual00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KDD17_13930    00074 Mycolic acid biosynthesis     KDD17_13930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KDD17_13930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MMR_HSR1 C2_TCB1 Motif Other DBs NCBI-ProteinID:  QUJ76013 UniProt:  A0A975JCP3 LinkDB All DBs Position 1:2833809..2834054 Genome browser AA seq 81 aa AA seqDB search MERTEILSIMNAIMAKKGRAEITDESQATRDVNFRSLDFSEAALRIEMKIDRELTFDAAS MRKIETVKDVLDFFEEATKPA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaacgcaccgaaatcctgagcatcatgaacgcgatcatggccaagaaaggccgtgcc gaaatcacggacgagagccaggcaacgcgcgacgtgaacttccgcagcctcgatttctcc gaggcggctctgcgcatcgagatgaagatcgaccgcgagctgacgttcgacgcggcctcc atgcgcaagatcgagacggtcaaggacgtgctcgacttcttcgaagaggccaccaaaccc gcatga

DBGET integrated database retrieval system