Sulfitobacter albidus: KDD17_15500 Help Entry KDD17_15500       CDS       T09114                                  Name (GenBank) rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism sual  Sulfitobacter albidus Pathway sual02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:sual00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     KDD17_15500  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:sual02035]     KDD17_15500 Bacterial motility proteins [BR:sual02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     KDD17_15500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  QUJ78076 UniProt:  A0A975JGF5 LinkDB All DBs Position 1:3175386..3175559 Genome browser AA seq 57 aa AA seqDB search MLKAAGLGKTSSEFGGGVGEDQFGSFLVTEQARAMVDAGGIGLAESLFDALKDQQDG NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atgctcaaggccgctgggcttggcaagaccagcagtgaattcggcggcggggtgggcgag gatcaattcggctcgtttctggtgaccgaacaggcgcgcgccatggtggacgccgggggc atcggcctggcggaatctcttttcgatgcgctcaaggaccagcaggatggatga

DBGET integrated database retrieval system