Sulfitobacter alexandrii: BOO69_11150 Help Entry BOO69_11150       CDS       T04555                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism suam  Sulfitobacter alexandrii Pathway suam03060   Protein export suam03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:suam00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BOO69_11150  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BOO69_11150  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:suam02044]     BOO69_11150 Secretion system [BR:suam02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    BOO69_11150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  APE43901 UniProt:  A0A1J0WHX5 LinkDB All DBs Position complement(2269423..2269686) Genome browser AA seq 87 aa AA seqDB search MLNNIGLPGLLLIAVVVLVLFGRGKISSLMGEVGKGITSFKKGISEGENETKQVDEVDSA ELPKHTDTGTHPRTDRVADKGVNRDKV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgttgaacaatattggcctgcccggtcttttgctgatcgcggtggtcgtgctcgtgctt ttcgggcgcggcaagatttccagcctgatgggtgaagtcggcaaggggatcacgagcttc aagaagggtatcagcgagggcgagaacgagacgaagcaggtcgacgaggtcgacagtgcc gaactgcccaagcataccgacaccggcacccatccccggaccgaccgggtcgccgacaag ggcgtgaaccgggacaaggtgtaa

DBGET integrated database retrieval system