Sphingobium fuliginis ATCC 27551: FIL70_02355 Help Entry FIL70_02355       CDS       T06343                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sufl  Sphingobium fuliginis ATCC 27551 Pathway sufl01100   Metabolic pathways sufl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sufl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIL70_02355    00074 Mycolic acid biosynthesis     FIL70_02355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIL70_02355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDC36256 UniProt:  A0A5B8CDA9 LinkDB All DBs Position cSF1:complement(494047..494337) Genome browser AA seq 96 aa AA seqDB search MRADNAQPVDRAMDIETMMRALLRDVLALSQDRVDAFDADTPLFGALPELDSMAVAGLLT EMEDRFGILIEDEDIDGDTFETFGSLVAFARAKIGG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcgggcggacaatgcacaaccggtcgaccgggcaatggatattgaaacgatgatgcgc gccttgctgcgcgatgtgctggccctgtcgcaggaccgggtggacgcctttgatgcggat acgccgctgttcggcgcgctgccggaactggactccatggccgttgcgggcctgctcacg gagatggaggaccgcttcggcatcctgatcgaggacgaggatatagacggcgatacgttc gagacgttcgggtcgctcgtcgcctttgcccgggcgaagatcgggggctga

DBGET integrated database retrieval system