Sphingobium fuliginis ATCC 27551: FIL70_02705 Help Entry FIL70_02705       CDS       T06343                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sufl  Sphingobium fuliginis ATCC 27551 Pathway sufl01100   Metabolic pathways sufl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sufl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIL70_02705    00074 Mycolic acid biosynthesis     FIL70_02705   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIL70_02705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  QDC36313 UniProt:  A0A5B8CAY0 LinkDB All DBs Position cSF1:570026..570259 Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgtcgaagcc gaaaaggtgaccgaggatgcgagcttcatcgacgatctgggcgctgacagcctggacatc gttgagctggtgatggcgttcgaggaagaattcggcgtcgaaatccccgacgatgcggcc gagaagatcgccaccgtcaaggatgccatcgattatatcgacagcaagcagtaa

DBGET integrated database retrieval system