Sphingobium fuliginis ATCC 27551: FIL70_06295 Help Entry FIL70_06295       CDS       T06343                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sufl  Sphingobium fuliginis ATCC 27551 Brite KEGG Orthology (KO) [BR:sufl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sufl03032]     FIL70_06295    03036 Chromosome and associated proteins [BR:sufl03036]     FIL70_06295    03400 DNA repair and recombination proteins [BR:sufl03400]     FIL70_06295 DNA replication proteins [BR:sufl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FIL70_06295 Chromosome and associated proteins [BR:sufl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FIL70_06295 DNA repair and recombination proteins [BR:sufl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FIL70_06295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 PqqD Motif Other DBs NCBI-ProteinID:  QDC36889 UniProt:  A0A5B8CC54 LinkDB All DBs Position cSF1:complement(1334687..1334962) Genome browser AA seq 91 aa AA seqDB search MNNSDLAEALAAEHDVTKADARKLVDAVFANIAGAAAKGEEISLNGFGKFKVKDQPAREG RNPSTGATIQIAASKKLAFTPAKAVKDQLNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaatagcgatctggctgaagcactggccgccgagcatgacgtcaccaaggccgat gcccgcaagctggtcgacgcggtcttcgcgaatatcgccggcgcagcagcgaagggcgaa gagatttcactgaacggtttcggcaagttcaaagtcaaggatcagcccgcccgcgaaggc cgcaatccctcgaccggcgcaacgatccagattgcggcgtcgaagaagcttgccttcacg cccgccaaggcggtcaaggatcagttgaacggctga

DBGET integrated database retrieval system