Sphingobium fuliginis ATCC 27551: FIL70_12345 Help Entry FIL70_12345       CDS       T06343                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sufl  Sphingobium fuliginis ATCC 27551 Pathway sufl01100   Metabolic pathways sufl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sufl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIL70_12345    00074 Mycolic acid biosynthesis     FIL70_12345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIL70_12345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QDC37910 UniProt:  A0A5B8CIM0 LinkDB All DBs Position cSF1:2572310..2572552 Genome browser AA seq 80 aa AA seqDB search MTDRQPIFDSVLSQIAPFNKKGVELTEATTFAGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETIGQLVDAVAKLKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacggatcgccagccaattttcgacagcgttttgagccagatcgcgcctttcaacaaa aagggcgtcgaactgaccgaagccaccaccttcgccggcgatctggaatgggacagcctg acggtgatggatttcgtcgccgcgatcgaggatgagttcgacatcatcatcaccatgaac atgcaggccgagatcgagaccatcggccagctcgtggacgccgtggcgaagctgaagggc tga

DBGET integrated database retrieval system