Sphingobium fuliginis ATCC 27551: FIL70_16860
Help
Entry
FIL70_16860 CDS
T06343
Symbol
rmuC
Name
(GenBank) DNA recombination protein RmuC
KO
K09760
DNA recombination protein RmuC
Organism
sufl
Sphingobium fuliginis ATCC 27551
Brite
KEGG Orthology (KO) [BR:
sufl00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99976 Replication and repair
FIL70_16860 (rmuC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RmuC
AAA_13
JetA
YwqH-like
DUF1664
Rootletin
DUF1455
PBECR5
Motif
Other DBs
NCBI-ProteinID:
QDC38665
UniProt:
A0A5B8CID9
LinkDB
All DBs
Position
cSF1:complement(3489882..3491315)
Genome browser
AA seq
477 aa
AA seq
DB search
MDSLAAILIIVALVAGLAIGWLARGRSVAPLLTEKADLAGKLDMAAAQRNAAIQELVVAQ
ERAAQAADLAQKLEAERAVREAAARELAALRSDTQARAEAFEAQIAALKDAKEQLSAQFS
EIGGKLLHQAQSHFLERADQRMMQAHEKSEAQLRQLLHPVNETIQRYDQKITQIEQQRTE
AYGILRGEIESMKSGQEAVRAEAQRLVDSLRHAPKARGRWGEQQLRNVLETCGLSEHVDF
RTEVSVEGEDGRLRPDAILRVPGGRALVIDAKVSLNAYQDAYGAEGEEERKRLLSAHAAA
MRAHVETLGRKSYADQFDEAPDYVIMFVPGEHFLSAALEHDPQLWDHAFGKRVLLATPTN
LIAIARTVAAVWRQEKMADEAKRIGMLGKELYERLAGAAASLKKLGNRLNGAVADYNSFV
GSFEGRVLVTGRKLRDLNIETGGKELEELEPVEALVREPSSAEAVRALPEALPDAAE
NT seq
1434 nt
NT seq
+upstream
nt +downstream
nt
atggacagcctggccgccattctcatcattgtcgctctggtcgcggggctggcgatcggc
tggctggcgcggggccggtccgtggcgccgctgctgacggaaaaggccgatctggcgggc
aagctggacatggcggcggcccagcgcaacgccgcgatccaggaactggtggtggcgcag
gagcgcgcggcgcaagcggcggatctggcgcagaagctggaggcggagcgcgcggtgcgg
gaagcggcggcgcgggaactggcggcgttgcgatccgacacgcaggcgcgggcggaagcc
ttcgaagcgcagatcgccgcgctcaaggatgcgaaggagcagctttcggcccagttcagc
gaaattggcggcaagctgctgcaccaggcgcagagccatttcctggaacgcgccgaccag
cgcatgatgcaggcgcatgagaagagtgaggcgcagctgaggcaattgctgcatccggtc
aacgagacgatccagcgttacgaccagaagatcacccagatcgagcagcagcggacggag
gcctatggcatactgcgcggcgagatcgaatcgatgaagtcggggcaggaggcggtgcgg
gccgaggcgcagcggctggtcgattcgctgcgccatgcgcccaaggcgcggggccgctgg
ggcgagcagcaattgcgcaatgtcctggagacatgcggcctttccgagcatgtggatttc
cggaccgaggtgagcgtggagggcgaggacggccggctgcgccccgacgcgatcctgcgc
gtgccgggcgggcgggcgctggtgattgacgccaaggtgtcgttgaatgcctatcaggac
gcctatggcgcggagggcgaggaggagaggaagcggctcctgtccgcccatgcggctgcg
atgcgtgcgcatgtcgagacgctggggcggaaaagctatgccgaccagttcgacgaagcg
cccgattatgtgatcatgttcgtgcccggcgaacatttcctctccgccgcgctggagcat
gatccgcagctttgggaccatgccttcgggaagcgggtgctgctggccacgccgaccaac
ctcatcgccattgcccggaccgtcgcggcggtttggcggcaggagaaaatggcggatgaa
gccaagcggatcggcatgctgggcaaggaactttacgagcggctggctggagcggcggcg
tcgctcaagaagctgggcaaccggctgaacggggccgttgcggattataacagcttcgtc
ggcagcttcgagggtcgcgtgctggtgacgggccgcaagctgcgcgacctgaatatcgag
acggggggcaaggaactggaagaactggagcccgtggaggcgctggttcgcgaaccgtcc
tcggctgaggccgtgcgggctttgccggaggcgctgccggatgcggcggagtag
DBGET
integrated database retrieval system