Sphingobium fuliginis ATCC 27551: FIL70_18940 Help Entry FIL70_18940       CDS       T06343                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism sufl  Sphingobium fuliginis ATCC 27551 Pathway sufl00361   Chlorocyclohexane and chlorobenzene degradation sufl00362   Benzoate degradation sufl00623   Toluene degradation sufl01100   Metabolic pathways sufl01120   Microbial metabolism in diverse environments sufl01220   Degradation of aromatic compounds Module sufl_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:sufl00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     FIL70_18940    00361 Chlorocyclohexane and chlorobenzene degradation     FIL70_18940    00623 Toluene degradation     FIL70_18940 Enzymes [BR:sufl01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      FIL70_18940     1.14.13.244  phenol 2-monooxygenase (NADH)      FIL70_18940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM SF3A3 Motif Other DBs NCBI-ProteinID:  QDC39321 UniProt:  A0A5B8CMA9 LinkDB All DBs Position cSF2:complement(81449..81721) Genome browser AA seq 90 aa AA seqDB search MSSTVFLALQANDDTRHVIDAIMADNPAASLDPQPAMVRITAPGTLVVRRETIEELIGRD FDLQELHVNMISLSGRVDETDDIFTLSWDR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaccgtcttcctcgcgcttcaggccaatgacgacacccgccatgtcatcgac gcgatcatggcggacaatcccgccgccagtctggacccgcagccggcgatggtgcgcatc accgcgccgggcacgctggtcgtgcgccgcgaaacaatcgaagagctgatcggccgcgat ttcgaccttcaggaactgcacgtcaacatgatctccctgtcgggccgcgtggacgagacc gacgacatcttcactctgagctgggaccgctga

DBGET integrated database retrieval system