Sphingobium fuliginis ATCC 27551: FIL70_18995 Help Entry FIL70_18995       CDS       T06343                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sufl  Sphingobium fuliginis ATCC 27551 Pathway sufl00362   Benzoate degradation sufl00621   Dioxin degradation sufl00622   Xylene degradation sufl01100   Metabolic pathways sufl01120   Microbial metabolism in diverse environments sufl01220   Degradation of aromatic compounds Module sufl_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:sufl00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     FIL70_18995    00622 Xylene degradation     FIL70_18995    00621 Dioxin degradation     FIL70_18995 Enzymes [BR:sufl01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      FIL70_18995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  QDC39331 UniProt:  A0A5B8CMB0 LinkDB All DBs Position cSF2:complement(90928..91131) Genome browser AA seq 67 aa AA seqDB search MPIISVVIGEGRSMEKKWAFIRALTRATVETMDVRPDQVRVILNETPLDHYAVAGVTFGE KAQQGQS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccgattatatccgtggtcattggcgaaggccgctcgatggaaaagaaatgggccttc atccgcgccctcaccagggcgacggtcgaaaccatggacgtgcgtcccgaccaggtgcgc gtgatcctgaacgaaacccccttggaccattatgccgtcgccggcgtgacgttcggcgaa aaggcgcagcagggacaaagttga

DBGET integrated database retrieval system