Streptococcus suis JS14 (serotype 14): SSUJS14_0026 Help Entry SSUJS14_0026      CDS       T02024                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sui  Streptococcus suis JS14 (serotype 14) Pathway sui01100   Metabolic pathways sui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SSUJS14_0026    00074 Mycolic acid biosynthesis     SSUJS14_0026   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SSUJS14_0026 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5578 DUF1493 Motif Other DBs NCBI-ProteinID:  ADV69138 LinkDB All DBs Position 30352..30600 Genome browser AA seq 82 aa AA seqDB search MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFVLNLEDEFHVDVPDAA IEHFEVLSDIVDFIYKEVKKRS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactagagagcaggtctatcagcgggttgttgaattaattcaggatgaaaagggagaa gattttcaagttcaacctgaatctactttggcagataatattgcagcagattcagtagaa atcatggaatttgttcttaatttggaggatgaatttcatgtagatgtcccagatgctgct attgagcattttgaggttctatctgatattgttgattttatttataaagaagtaaaaaaa cgttcgtag

DBGET integrated database retrieval system