Sulfurimonas sp. CVO: CVO_02075 Help Entry CVO_02075         CDS       T06373                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sulc  Sulfurimonas sp. CVO Pathway sulc01100   Metabolic pathways sulc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sulc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CVO_02075 (acpP)    00074 Mycolic acid biosynthesis     CVO_02075 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CVO_02075 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Ribosomal_L12_N PRD Motif Other DBs NCBI-ProteinID:  QHG90698 LinkDB All DBs Position 402466..402693 Genome browser AA seq 75 aa AA seqDB search MALLDDIREVVVEQLGVNADEVKEDAKFVEDLGADSLDVVELVMALEEKFDIEIPDDEAE KIQTVKDVVNYIENK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcacttttagatgatattagagaagtagtagttgagcaattaggcgttaacgctgat gaggtaaaagaggatgcaaagtttgttgaagatttaggtgctgatagccttgatgtagtt gaattagtaatggctcttgaggaaaaatttgatattgaaattcctgatgatgaagcggaa aaaattcaaactgttaaagatgtagtaaactatatcgaaaacaagtaa

DBGET integrated database retrieval system