Sulfitobacter sp. D7: B5M07_01320 Help Entry B5M07_01320       CDS       T05714                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism suld  Sulfitobacter sp. D7 Brite KEGG Orthology (KO) [BR:suld00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:suld03032]     B5M07_01320    03036 Chromosome and associated proteins [BR:suld03036]     B5M07_01320    03400 DNA repair and recombination proteins [BR:suld03400]     B5M07_01320 DNA replication proteins [BR:suld03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     B5M07_01320 Chromosome and associated proteins [BR:suld03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     B5M07_01320 DNA repair and recombination proteins [BR:suld03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       B5M07_01320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AYE84864 UniProt:  A0A386TAC7 LinkDB All DBs Position complement(283966..284253) Genome browser AA seq 95 aa AA seqDB search MAKPMTKTQLVAALAEEMDTDKKSAGAALDAVCNLITREVSAGGAVTLPGVGKIYCRERP ERMVRNPATGEQFKKDADKVVKMTIAKALKDSVNE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaccgatgaccaagacccagctcgttgctgctctggcagaagagatggacacc gacaagaaatccgcaggcgcagcgctcgacgccgtttgcaacctgatcacccgtgaagtg tccgccggcggtgccgtgaccctgccgggcgttggcaaaatctattgccgtgagcgcccc gagcggatggtccgcaaccccgccactggcgagcagttcaagaaagacgccgacaaagtg gtcaagatgaccatcgcgaaggcgctgaaggacagcgtgaacgagtaa

DBGET integrated database retrieval system