Sulfitobacter sp. D7: B5M07_07205
Help
Entry
B5M07_07205 CDS
T05714
Name
(GenBank) thiaminase II
KO
K03707
thiaminase (transcriptional activator TenA) [EC:
3.5.99.2
]
Organism
suld
Sulfitobacter sp. D7
Pathway
suld00730
Thiamine metabolism
suld01100
Metabolic pathways
suld01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
suld00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00730 Thiamine metabolism
B5M07_07205
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
suld03000
]
B5M07_07205
Enzymes [BR:
suld01000
]
3. Hydrolases
3.5 Acting on carbon-nitrogen bonds, other than peptide bonds
3.5.99 In other compounds
3.5.99.2 aminopyrimidine aminohydrolase
B5M07_07205
Transcription factors [BR:
suld03000
]
Prokaryotic type
Other transcription factors
Others
B5M07_07205
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TENA_THI-4
Motif
Other DBs
NCBI-ProteinID:
AYE85914
LinkDB
All DBs
Position
complement(1483695..1484378)
Genome browser
AA seq
227 aa
AA seq
DB search
MTAPDYGDAFAAWRSGAGEAWRDYTRHAFVEELRAGTLPQASYLHYLRQDYVFLIHFARA
WALAAAKAETLDEMAAASATVHALVHVEMPLHVETCARQGIDRATLEATAEAPGNLAYTR
YVLEAGYSGDFLDLMAALAPCVLGYGEIGLSLRGNDGPYADWCAVYGGEDYQALCRDVGA
LIDGALRRRLSAEWKTLPRAKTLQERFNTATRLEVGFWGMALAPAAP
NT seq
684 nt
NT seq
+upstream
nt +downstream
nt
atgacggcacccgactacggcgatgcctttgccgcatggcgcagcggcgccggagaggcg
tggcgggactacacccgccatgcctttgtcgaagagttgcgcgcggggacgctgccacag
gccagctatctgcactatctacggcaggactatgtctttctgatccatttcgcccgcgca
tgggcgctggccgcagccaaggcggaaacgctggatgagatggccgcagccagtgccacg
gttcatgcgcttgttcatgtagagatgccactgcatgtggaaacctgtgcccgccaaggc
atcgaccgcgccacgcttgaggccacggcagaggcaccgggcaacctcgcctatacacgc
tatgttttagaggcgggctattccggtgatttccttgatctgatggccgcacttgcgccc
tgtgtgttgggctatggtgagattgggctgagccttcggggcaatgatggcccctatgcc
gattggtgcgccgtctatggcggcgaagattaccaagcgctttgccgggatgttggtgct
ttgatcgacggcgcattgcggcggcgtctgagcgcggaatggaaaacactgccgcgcgcc
aaaaccctgcaagagcgtttcaataccgcgacccggcttgaggttggtttctggggcatg
gcgcttgcgcccgccgcaccatga
DBGET
integrated database retrieval system