KEGG   Sulfitobacter sp. D7: B5M07_07205
Entry
B5M07_07205       CDS       T05714                                 
Name
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00730  Thiamine metabolism
suld01100  Metabolic pathways
suld01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    B5M07_07205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:suld03000]
    B5M07_07205
Enzymes [BR:suld01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     B5M07_07205
Transcription factors [BR:suld03000]
 Prokaryotic type
  Other transcription factors
   Others
    B5M07_07205
SSDB
Motif
Pfam: TENA_THI-4
Other DBs
NCBI-ProteinID: AYE85914
LinkDB
Position
complement(1483695..1484378)
AA seq 227 aa
MTAPDYGDAFAAWRSGAGEAWRDYTRHAFVEELRAGTLPQASYLHYLRQDYVFLIHFARA
WALAAAKAETLDEMAAASATVHALVHVEMPLHVETCARQGIDRATLEATAEAPGNLAYTR
YVLEAGYSGDFLDLMAALAPCVLGYGEIGLSLRGNDGPYADWCAVYGGEDYQALCRDVGA
LIDGALRRRLSAEWKTLPRAKTLQERFNTATRLEVGFWGMALAPAAP
NT seq 684 nt   +upstreamnt  +downstreamnt
atgacggcacccgactacggcgatgcctttgccgcatggcgcagcggcgccggagaggcg
tggcgggactacacccgccatgcctttgtcgaagagttgcgcgcggggacgctgccacag
gccagctatctgcactatctacggcaggactatgtctttctgatccatttcgcccgcgca
tgggcgctggccgcagccaaggcggaaacgctggatgagatggccgcagccagtgccacg
gttcatgcgcttgttcatgtagagatgccactgcatgtggaaacctgtgcccgccaaggc
atcgaccgcgccacgcttgaggccacggcagaggcaccgggcaacctcgcctatacacgc
tatgttttagaggcgggctattccggtgatttccttgatctgatggccgcacttgcgccc
tgtgtgttgggctatggtgagattgggctgagccttcggggcaatgatggcccctatgcc
gattggtgcgccgtctatggcggcgaagattaccaagcgctttgccgggatgttggtgct
ttgatcgacggcgcattgcggcggcgtctgagcgcggaatggaaaacactgccgcgcgcc
aaaaccctgcaagagcgtttcaataccgcgacccggcttgaggttggtttctggggcatg
gcgcttgcgcccgccgcaccatga

DBGET integrated database retrieval system